Nmr structure of non-sweet mutant (ins18ri19) of sweet protein brazzein
PDB DOI: 10.2210/pdb2n69/pdb
Classification: PLANT PROTEIN Organism(s): Pentadiplandra Brazzeana
Deposited: 2015-08-14 Deposition Author(s): Assadi-Porter, F. , Markley, J.L. , Singarapu, K.K. , Tonelli, M.
Nmr structure of non-sweet mutant (ins18ri19) of sweet protein brazzein
Assadi-Porter, F. , Markley, J.L. , Singarapu, K.K. , Tonelli, M.
Primary Citation of Related Structures: 2N69
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Defensin-like protein | A | 56 | Pentadiplandra Brazzeana | QDKCKKVYENYPVSKCQLRIANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY |
Method: SOLUTION NMR
Deposited Date: 2015-08-14 Deposition Author(s): Assadi-Porter, F. , Markley, J.L. , Singarapu, K.K. , Tonelli, M.