Nmr structure of fbp28 ww domain t456y mutant
PDB DOI: 10.2210/pdb2n4w/pdb
Classification: TRANSCRIPTION Organism(s): Homo Sapiens
Deposited: 2015-07-01 Deposition Author(s): Macias, M. , Martin-Malpartida, P. , Medina, J. , Scheraga, H.A.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of fbp28 ww domain t456y mutant
Macias, M. , Martin-Malpartida, P. , Medina, J. , Scheraga, H.A.
Primary Citation of Related Structures: 2N4W
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription elongation regulator 1 | A | 37 | Homo Sapiens | GATAVSEWTEYKTADGKTYYYNNRTLESYWEKPQELK |
Method: SOLUTION NMR
Deposited Date: 2015-07-01 Deposition Author(s): Macias, M. , Martin-Malpartida, P. , Medina, J. , Scheraga, H.A.