Solution structure of the rpn1 substrate receptor site toroid 1 (t1)
PDB DOI: 10.2210/pdb2n3t/pdb
Classification: PROTEIN BINDING Organism(s): Saccharomyces Cerevisiae
Deposited: 2015-06-10 Deposition Author(s): Chen, X. , Walters, K.J.
Solution structure of the rpn1 substrate receptor site toroid 1 (t1)
Primary Citation of Related Structures: 2N3T
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 26S proteasome regulatory subunit RPN1 | A | 131 | Saccharomyces Cerevisiae | DTKISSAAILGLGIAFAGSKNDEVLGLLLPIAASTDLPIETAAMASLALAHVFVGTCNGDITTSIMDNFLERTAIELKTDWVRFLALALGILYMGQGEQVDDVLETISAIEHPMTSAIEVLVGSCAYTGTG |
Method: SOLUTION NMR
Deposited Date: 2015-06-10 Deposition Author(s): Chen, X. , Walters, K.J.