Fusion to a highly stable consensus albumin binding domain allows for tunable pharmacokinetics
PDB DOI: 10.2210/pdb2n35/pdb
Classification: DE NOVO PROTEIN Organism(s): Synthetic Construct
Deposited: 2015-05-21 Deposition Author(s): Gibbs, A.C. , Jacobs, S.A.
Fusion to a highly stable consensus albumin binding domain allows for tunable pharmacokinetics
Primary Citation of Related Structures: 2N35
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Albumin binding protein | A | 52 | Synthetic Construct | GTIDEWLLKEAKEKAIEELKKAGITSDYYFDLINKAKTVEGVNALKDEILKA |
Method: SOLUTION NMR
Deposited Date: 2015-05-21 Deposition Author(s): Gibbs, A.C. , Jacobs, S.A.