Structure of the c-terminal membrane domain of hcv ns5b protein
PDB DOI: 10.2210/pdb2n1p/pdb
Classification: VIRAL PROTEIN Organism(s): N.A.
Deposited: 2015-04-15 Deposition Author(s): Montserret, R. , Penin, F.
Structure of the c-terminal membrane domain of hcv ns5b protein
Primary Citation of Related Structures: 2N1P
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Non-structural protein 5B, NS5B | A | 30 | N.A. | HSVSHARPRWFWFSLLLLAAGVGIYLLPNR |
Method: SOLUTION NMR
Deposited Date: 2015-04-15 Deposition Author(s): Montserret, R. , Penin, F.