Nmr structure of a kazal-type serine protease inhibitor from the subterranean termite defense gland of coptotermes formosanus shiraki soldiers
PDB DOI: 10.2210/pdb2n17/pdb
Classification: HYDROLASE Organism(s): Coptotermes Formosanus
Deposited: 2015-03-23 Deposition Author(s): Garner, T.P. , Goodwin, O.Y. , Guo, Y. , Henderson, G. , Laine, R.A. , Macnaughtan, M.A. , Negulescu, H.
Nmr structure of a kazal-type serine protease inhibitor from the subterranean termite defense gland of coptotermes formosanus shiraki soldiers
Garner, T.P. , Goodwin, O.Y. , Guo, Y. , Henderson, G. , Laine, R.A. , Macnaughtan, M.A. , Negulescu, H.
Primary Citation of Related Structures: 2N17
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Lysozyme-Protease Inhibitor Protein | A | 75 | Coptotermes Formosanus | MAHHHHHHVDDDDKPEDCQLFCPMIYAPICATDGVSQRTFSNPCDLKVYNCWNPDNPYKEVKVGECDDANKPVPI |
Method: SOLUTION NMR
Deposited Date: 2015-03-23 Deposition Author(s): Garner, T.P. , Goodwin, O.Y. , Guo, Y. , Henderson, G. , Laine, R.A. , Macnaughtan, M.A. , Negulescu, H.