Structure of tau(267-312) bound to microtubules
PDB DOI: 10.2210/pdb2mz7/pdb
Classification: PROTEIN BINDING Organism(s): N.A.
Deposited: 2015-02-06 Deposition Author(s): Jaremko, L. , Jaremko, M. , Kadavath, H. , Zweckstetter, M.
Structure of tau(267-312) bound to microtubules
Jaremko, L. , Jaremko, M. , Kadavath, H. , Zweckstetter, M.
Primary Citation of Related Structures: 2MZ7
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Microtubule-associated protein tau | A | 46 | N.A. | KHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKP |
Method: SOLUTION NMR
Deposited Date: 2015-02-06 Deposition Author(s): Jaremko, L. , Jaremko, M. , Kadavath, H. , Zweckstetter, M.