Omega-tbo-it1: selective inhibitor of insect calcium channels isolated from tibellus oblongus spider venom
PDB DOI: 10.2210/pdb2myh/pdb
Classification: TOXIN Organism(s): Tibellus Oblongus
Deposited: 2015-01-23 Deposition Author(s): Altukhov, D. , Bocharov, E. , Bozin, T. , Kozlov, S. , Mikov, A.
Method: SOLUTION NMR Resolution: N.A.
Omega-tbo-it1: selective inhibitor of insect calcium channels isolated from tibellus oblongus spider venom
Altukhov, D. , Bocharov, E. , Bozin, T. , Kozlov, S. , Mikov, A.
Primary Citation of Related Structures: 2MYH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Omega-Tbo-IT1 toxin | A | 41 | Tibellus Oblongus | CASKNERCGNALYGTKGPGCCNGKCICRTVPRKGVNSCRCM |
Method: SOLUTION NMR
Deposited Date: 2015-01-23 Deposition Author(s): Altukhov, D. , Bocharov, E. , Bozin, T. , Kozlov, S. , Mikov, A.