Complex structure of dvl pdz domain with ligand
PDB DOI: 10.2210/pdb2mx6/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-12-15 Deposition Author(s): Zhang, X. , Zheng, J.J.
Complex structure of dvl pdz domain with ligand
Primary Citation of Related Structures: 2MX6
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Segment polarity protein dishevelled homolog DVL-1 | A | 90 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | NIITVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAK |
(PHQ)WV peptide | B | 3 | Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | XWV |
Method: SOLUTION NMR
Deposited Date: 2014-12-15 Deposition Author(s): Zhang, X. , Zheng, J.J.