Structure of the s-glycosylated bacteriocin asm1
PDB DOI: 10.2210/pdb2mvi/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): Lactobacillus Plantarum
Deposited: 2014-10-06 Deposition Author(s): Goroncy, A.K. , Koolard, A. , Loo, T.S. , Norris, G.E. , Patchett, M.L.
Method: SOLUTION NMR Resolution: N.A.
Structure of the s-glycosylated bacteriocin asm1
Goroncy, A.K. , Koolard, A. , Loo, T.S. , Norris, G.E. , Patchett, M.L.
Primary Citation of Related Structures: 2MVI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bacteriocin plantarican ASM1 | A | 43 | Lactobacillus Plantarum | KPAWCWYTLAMCGAGYDSGTCDYMYSHCFGVKHSSGGGGSYHC |
Method: SOLUTION NMR
Deposited Date: 2014-10-06 Deposition Author(s): Goroncy, A.K. , Koolard, A. , Loo, T.S. , Norris, G.E. , Patchett, M.L.