Solution structure of ovis aries prp with mutation delta193-196
PDB DOI: 10.2210/pdb2mv9/pdb
Classification: IMMUNE SYSTEM Organism(s): Ovis Aries
Deposited: 2014-09-25 Deposition Author(s): Beringue, V. , Dron, M. , Egalon, A. , Munoz, C. , Rezaei, H. , Sizun, C.
Solution structure of ovis aries prp with mutation delta193-196
Beringue, V. , Dron, M. , Egalon, A. , Munoz, C. , Rezaei, H. , Sizun, C.
Primary Citation of Related Structures: 2MV9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Major prion protein | A | 150 | Ovis Aries | MGSSHHHHHHSSGLVPRGSHMSNKPSKPKTNMKHVAGAAAAGAVVGGLGGYMLGSVMSRPLIHFGNDYEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITVKQHTVKGENFTETDIKIMERVVEQMCITQYQRESQAYYQRGAS |
Method: SOLUTION NMR
Deposited Date: 2014-09-25 Deposition Author(s): Beringue, V. , Dron, M. , Egalon, A. , Munoz, C. , Rezaei, H. , Sizun, C.