Solution structure of the phd domain of yeast yng2
PDB DOI: 10.2210/pdb2mum/pdb
Classification: Transcription Regulator Organism(s): Saccharomyces Cerevisiae S288C
Deposited: 2014-09-12 Deposition Author(s): Farhadi, S. , Kaustov, L. , Lemak, A. , Sheng, Y. , Taeb, S.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the phd domain of yeast yng2
Farhadi, S. , Kaustov, L. , Lemak, A. , Sheng, Y. , Taeb, S.
Primary Citation of Related Structures: 2MUM
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Chromatin modification-related protein YNG2 | A | 50 | Saccharomyces Cerevisiae S288C | TLYCFCQRVSFGEMVACDGPNCKYEWFHYDCVNLKEPPKGTWYCPECKIE |
Method: SOLUTION NMR
Deposited Date: 2014-09-12 Deposition Author(s): Farhadi, S. , Kaustov, L. , Lemak, A. , Sheng, Y. , Taeb, S.