Structural investigation of hnrnp l bound to rna
PDB DOI: 10.2210/pdb2mqo/pdb
Classification: RNA BINDING PROTEIN/RNA Organism(s): Rattus Norvegicus , Synthetic Construct
Deposited: 2014-06-24 Deposition Author(s): Allain, F. , Blatter, M.
Structural investigation of hnrnp l bound to rna
Primary Citation of Related Structures: 2MQO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein Hnrnpl | A | 105 | Rattus Norvegicus , Synthetic Construct | GENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNS |
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RNA (5'-R(*CP*AP*CP*AP*CP*A)-3') | b | 6 | NA | CACACA |
Method: SOLUTION NMR
Deposited Date: 2014-06-24 Deposition Author(s): Allain, F. , Blatter, M.