Nmr structure of the c3 domain of human cardiac myosin binding protein-c with a hypertrophic cardiomyopathy-related mutation r502w.
PDB DOI: 10.2210/pdb2mq3/pdb
Classification: CONTRACTILE PROTEIN Organism(s): Homo Sapiens
Deposited: 2014-06-12 Deposition Author(s): De, S. , Mcintosh, L.P. , Paetzel, M. , Zhang, X.
Nmr structure of the c3 domain of human cardiac myosin binding protein-c with a hypertrophic cardiomyopathy-related mutation r502w.
De, S. , Mcintosh, L.P. , Paetzel, M. , Zhang, X.
Primary Citation of Related Structures: 2MQ3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Myosin-binding protein C, cardiac-type | A | 95 | Homo Sapiens | GSHMPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYWFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEK |
Method: SOLUTION NMR
Deposited Date: 2014-06-12 Deposition Author(s): De, S. , Mcintosh, L.P. , Paetzel, M. , Zhang, X.