2MPI
Solution structure of b24g insulin
PDB DOI: 10.2210/pdb2mpi/pdb
Classification: PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2014-05-19 Deposition Author(s): Hua, Q. , Weiss, M.A. , Wickramasinghe, N.P. , Yang, Y.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of b24g insulin
Hua, Q. , Weiss, M.A. , Wickramasinghe, N.P. , Yang, Y.
Primary Citation of Related Structures: 2MPI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| insulin chain A | A | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
| insulin chain B | B | 30 | Homo Sapiens | FVNQHLCGSDLVEALYLVCGERGGFYTKPT |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2014-05-19 Deposition Author(s): Hua, Q. , Weiss, M.A. , Wickramasinghe, N.P. , Yang, Y.