Solution structure of b24g insulin
PDB DOI: 10.2210/pdb2mpi/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica
Deposited: 2014-05-19 Deposition Author(s): Hua, Q. , Weiss, M.A. , Wickramasinghe, N.P. , Yang, Y.
Solution structure of b24g insulin
Hua, Q. , Weiss, M.A. , Wickramasinghe, N.P. , Yang, Y.
Primary Citation of Related Structures: 2MPI
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
insulin chain A | A | 21 | Salmonella Enterica | GIVEQCCTSICSLYQLENYCN |
insulin chain B | B | 30 | Salmonella Enterica | FVNQHLCGSDLVEALYLVCGERGGFYTKPT |
Method: SOLUTION NMR
Deposited Date: 2014-05-19 Deposition Author(s): Hua, Q. , Weiss, M.A. , Wickramasinghe, N.P. , Yang, Y.