Solution structure of the [aibb8,lysb28,prob29]-insulin analogue
PDB DOI: 10.2210/pdb2mpg/pdb
Classification: HORMONE Organism(s): Homo Sapiens
Deposited: 2014-05-17 Deposition Author(s): Jiracek, J. , Kosinova, L. , Veverka, V. , Zakova, L.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the [aibb8,lysb28,prob29]-insulin analogue
Jiracek, J. , Kosinova, L. , Veverka, V. , Zakova, L.
Primary Citation of Related Structures: 2MPG
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Insulin A chain | A | 21 | Homo Sapiens | GIVEQCCTSICSLYQLENYCN |
Insulin B chain | B | 30 | Homo Sapiens | FVNQHLCASHLVEALYLVCGERGFFYTKPT |
Method: SOLUTION NMR
Deposited Date: 2014-05-17 Deposition Author(s): Jiracek, J. , Kosinova, L. , Veverka, V. , Zakova, L.