Structural insights of tm domain of lamp-2a in dpc micelles
PDB DOI: 10.2210/pdb2mof/pdb
Classification: MEMBRANE PROTEIN Organism(s): Homo Sapiens
Deposited: 2014-04-25 Deposition Author(s): Rout, A. , Tjandra, N.
Structural insights of tm domain of lamp-2a in dpc micelles
Primary Citation of Related Structures: 2MOF
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Lysosome-associated membrane glycoprotein 2 | A | 42 | Homo Sapiens | SADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF |
Method: SOLUTION NMR
Deposited Date: 2014-04-25 Deposition Author(s): Rout, A. , Tjandra, N.