Nmr structure of kdm5b phd1 finger in complex with h3k4me0(1-10aa)
PDB DOI: 10.2210/pdb2mnz/pdb
Classification: OXIDOREDUCTASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2014-04-16 Deposition Author(s): Cao, C. , Guo, X. , Lan, W.X. , Rong, N.Y. , Song, Y.J. , Xu, Y.H. , Xu, Y.W. , Yang, H.R. , Zhang, Y.
Nmr structure of kdm5b phd1 finger in complex with h3k4me0(1-10aa)
Cao, C. , Guo, X. , Lan, W.X. , Rong, N.Y. , Song, Y.J. , Xu, Y.H. , Xu, Y.W. , Yang, H.R. , Zhang, Y.
Primary Citation of Related Structures: 2MNZ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Lysine-specific demethylase 5B | A | 55 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AVDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGDWRCPKCLAQE |
H3K4me0 | B | 10 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARTKQTARKS |
Method: SOLUTION NMR
Deposited Date: 2014-04-16 Deposition Author(s): Cao, C. , Guo, X. , Lan, W.X. , Rong, N.Y. , Song, Y.J. , Xu, Y.H. , Xu, Y.W. , Yang, H.R. , Zhang, Y.