Solution structures of active ptr toxb and its inactive homolog highlight protein dynamics as a modulator of toxin activity
PDB DOI: 10.2210/pdb2mm0/pdb
Classification: TOXIN Organism(s): Pyrenophora Tritici-Repentis
Deposited: 2014-03-06 Deposition Author(s): Barbar, E. , Ciuffetti, L. , Figueroa, M. , Manning, V. , Nyarko, A. , Pandelova, I. , Singarapu, K. , Wolpert, T.
Solution structures of active ptr toxb and its inactive homolog highlight protein dynamics as a modulator of toxin activity
Barbar, E. , Ciuffetti, L. , Figueroa, M. , Manning, V. , Nyarko, A. , Pandelova, I. , Singarapu, K. , Wolpert, T.
Primary Citation of Related Structures: 2MM0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Host-selective toxin protein | A | 64 | Pyrenophora Tritici-Repentis | NCVANILNINEAVIATGCVPAGGELRIFVGSSHSYLIKATSSCGLSLTNQVFINGESVQSGGRC |
Method: SOLUTION NMR
Deposited Date: 2014-03-06 Deposition Author(s): Barbar, E. , Ciuffetti, L. , Figueroa, M. , Manning, V. , Nyarko, A. , Pandelova, I. , Singarapu, K. , Wolpert, T.