Structural characterization of interactions between the double-stranded rna-binding zinc finger protein jaz and dsrna
PDB DOI: 10.2210/pdb2mkn/pdb
Classification: RNA BINDING PROTEIN/RNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2014-02-10 Deposition Author(s): Burge, R. , Dyson, J. , Martinez-Yamout, M. , Wright, P.
Structural characterization of interactions between the double-stranded rna-binding zinc finger protein jaz and dsrna
Burge, R. , Dyson, J. , Martinez-Yamout, M. , Wright, P.
Primary Citation of Related Structures: 2MKN
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Zinc finger protein 346 | A | 60 | Homo Sapiens , Synthetic Construct | STKVEALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHRKQETKLKLMARYGRLAD |
Method: SOLUTION NMR
Deposited Date: 2014-02-10 Deposition Author(s): Burge, R. , Dyson, J. , Martinez-Yamout, M. , Wright, P.