Spatial structure of the toll-like receptor 3 transmembrane domain in the trimeric state
PDB DOI: 10.2210/pdb2mka/pdb
Classification: IMMUNE SYSTEM Organism(s): Homo Sapiens
Deposited: 2014-02-04 Deposition Author(s): Arseniev, A.S. , Gonscharuk, S.A. , Mineev, K.
Spatial structure of the toll-like receptor 3 transmembrane domain in the trimeric state
Arseniev, A.S. , Gonscharuk, S.A. , Mineev, K.
Primary Citation of Related Structures: 2MKA
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Toll-like receptor 3 | A | 34 | Homo Sapiens | MDSAPFELFFMINTSILLIFIFIVLLIHFEGWRI |
Toll-like receptor 3 | B | 34 | Homo Sapiens | MDSAPFELFFMINTSILLIFIFIVLLIHFEGWRI |
Toll-like receptor 3 | C | 34 | Homo Sapiens | MDSAPFELFFMINTSILLIFIFIVLLIHFEGWRI |
Method: SOLUTION NMR
Deposited Date: 2014-02-04 Deposition Author(s): Arseniev, A.S. , Gonscharuk, S.A. , Mineev, K.