Spatial structure of the dimeric transmembrane domain of toll-like receptor 3
PDB DOI: 10.2210/pdb2mk9/pdb
Classification: IMMUNE SYSTEM Organism(s): Homo Sapiens
Deposited: 2014-02-04 Deposition Author(s): Arseniev, A.S. , Goncharuk, S.A. , Mineev, K.S.
Spatial structure of the dimeric transmembrane domain of toll-like receptor 3
Arseniev, A.S. , Goncharuk, S.A. , Mineev, K.S.
Primary Citation of Related Structures: 2MK9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Toll-like receptor 3 | A | 34 | Homo Sapiens | MDSAPFELFFMINTSILLIFIFIVLLIHFEGWRI |
| Toll-like receptor 3 | B | 34 | Homo Sapiens | MDSAPFELFFMINTSILLIFIFIVLLIHFEGWRI |
Method: SOLUTION NMR
Deposited Date: 2014-02-04 Deposition Author(s): Arseniev, A.S. , Goncharuk, S.A. , Mineev, K.S.