Solution nmr structure of gp41 ectodomain monomer on a dpc micelle
PDB DOI: 10.2210/pdb2mk3/pdb
Classification: IMMUNE SYSTEM Organism(s): Human Immunodeficiency Virus 1
Deposited: 2014-01-23 Deposition Author(s): Bax, A. , Grishaev, A. , Louis, J.M. , Roche, J. , Ying, J.
Solution nmr structure of gp41 ectodomain monomer on a dpc micelle
Bax, A. , Grishaev, A. , Louis, J.M. , Roche, J. , Ying, J.
Primary Citation of Related Structures: 2MK3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transmembrane glycoprotein, chimeric construct | A | 72 | Human Immunodeficiency Virus 1 | GSHMSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIEESQNQQEK |
Method: SOLUTION NMR
Deposited Date: 2014-01-23 Deposition Author(s): Bax, A. , Grishaev, A. , Louis, J.M. , Roche, J. , Ying, J.