Designed exendin-4 analogues
PDB DOI: 10.2210/pdb2mj9/pdb
Classification: TOXIN Organism(s): Heloderma Suspectum
Deposited: 2013-12-30 Deposition Author(s): Farkas, V. , Hegyi, O. , Jermendy, A. , Perczel, A. , Rovo, P. , Straner, P. , Szabo, M. , Toth, G.K.
Designed exendin-4 analogues
Farkas, V. , Hegyi, O. , Jermendy, A. , Perczel, A. , Rovo, P. , Straner, P. , Szabo, M. , Toth, G.K.
Primary Citation of Related Structures: 2MJ9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Exendin-4 | A | 39 | Heloderma Suspectum | HGEGTFTSDLSKQMEEEAVRLYIQWLKEGGPSSGRPPPS |
Method: SOLUTION NMR
Deposited Date: 2013-12-30 Deposition Author(s): Farkas, V. , Hegyi, O. , Jermendy, A. , Perczel, A. , Rovo, P. , Straner, P. , Szabo, M. , Toth, G.K.