Nmr structure of the s-linked glycopeptide sublancin 168
PDB DOI: 10.2210/pdb2mij/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): Bacillus Subtilis
Deposited: 2013-12-13 Deposition Author(s): Garcia De Gonzalo, C.V. , Oman, T.J. , Van Der Donk, W.A. , Zhu, L.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of the s-linked glycopeptide sublancin 168
Garcia De Gonzalo, C.V. , Oman, T.J. , Van Der Donk, W.A. , Zhu, L.
Primary Citation of Related Structures: 2MIJ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| SPBc2 prophage-derived bacteriocin sublancin-168 | A | 37 | Bacillus Subtilis | GLGKAQCAALWLQCASGGTIGCGGGAVACQNYRQFCR |
Method: SOLUTION NMR
Deposited Date: 2013-12-13 Deposition Author(s): Garcia De Gonzalo, C.V. , Oman, T.J. , Van Der Donk, W.A. , Zhu, L.