Solution structure of allatide c4, conformation 2
PDB DOI: 10.2210/pdb2mia/pdb
Classification: HYDROLASE INHIBITOR Organism(s): Allamanda Cathartica
Deposited: 2013-12-12 Deposition Author(s): Bai, Y. , Pervushin, K.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of allatide c4, conformation 2
Primary Citation of Related Structures: 2MIA
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| alpha amylase inhibitor | A | 30 | Allamanda Cathartica | CIAHYGKCDGIINQCCDPWLCTPPIIGFCL |
Method: SOLUTION NMR
Deposited Date: 2013-12-12 Deposition Author(s): Bai, Y. , Pervushin, K.