Solution structure of the carboxy terminal domain of nusg from mycobacterium tuberculosis
PDB DOI: 10.2210/pdb2mi6/pdb
Classification: TRANSCRIPTION Organism(s): Mycobacterium Tuberculosis
Deposited: 2013-12-09 Deposition Author(s): Roesch, P. , Schweimer, K. , Strauss, M.
Solution structure of the carboxy terminal domain of nusg from mycobacterium tuberculosis
Roesch, P. , Schweimer, K. , Strauss, M.
Primary Citation of Related Structures: 2MI6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Transcription termination/antitermination protein NusG | A | 62 | Mycobacterium Tuberculosis | GRPVVEVDYEVGESVTVMDGPFATLPATISEVNAEQQKLKVLVSIFGRETPVELTFGQVSKI |
Method: SOLUTION NMR
Deposited Date: 2013-12-09 Deposition Author(s): Roesch, P. , Schweimer, K. , Strauss, M.