Structure determination of the salamander courtship pheromone plethodontid modulating factor
PDB DOI: 10.2210/pdb2mhy/pdb
Classification: SIGNALING PROTEIN Organism(s): Plethodon Shermani
Deposited: 2013-12-05 Deposition Author(s): Arumugam, S. , Bowen, K.E. , Doty, K.A. , Feldhoff, P.W. , Feldhoff, R.C. , Lane, A.N. , Wilburn, D.B.
Structure determination of the salamander courtship pheromone plethodontid modulating factor
Arumugam, S. , Bowen, K.E. , Doty, K.A. , Feldhoff, P.W. , Feldhoff, R.C. , Lane, A.N. , Wilburn, D.B.
Primary Citation of Related Structures: 2MHY
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Plethodontid modulating factor | A | 57 | Plethodon Shermani | LQCNTLDGGTEECIPGIYNVCVHYKSEDEEYKSCGIQEECEDAEGATVLCCPEDLCN |
Method: SOLUTION NMR
Deposited Date: 2013-12-05 Deposition Author(s): Arumugam, S. , Bowen, K.E. , Doty, K.A. , Feldhoff, P.W. , Feldhoff, R.C. , Lane, A.N. , Wilburn, D.B.