Structure of plasmodium yoelii merozoite surface protein 1 - c-terminal domain
PDB DOI: 10.2210/pdb2mgp/pdb
Classification: MEMBRANE PROTEIN Organism(s): Plasmodium Yoelii Yoelii
Deposited: 2013-11-03 Deposition Author(s): Birdsall, B. , Curd, R.D. , Holder, A.A. , Kadekoppala, M. , Kelly, G. , Ogun, S.
Structure of plasmodium yoelii merozoite surface protein 1 - c-terminal domain
Birdsall, B. , Curd, R.D. , Holder, A.A. , Kadekoppala, M. , Kelly, G. , Ogun, S.
Primary Citation of Related Structures: 2MGP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Merozoite surface protein 1 | A | 99 | Plasmodium Yoelii Yoelii | GVDPKHVCVDTRDIPKNAGCFRDDDGTEEWRCLLGYKKGEGNTCVENNNPTCDINNGGCDPTASCQNAESTENSKKIICTCKEPTPNAYYEGVFCSSSS |
Method: SOLUTION NMR
Deposited Date: 2013-11-03 Deposition Author(s): Birdsall, B. , Curd, R.D. , Holder, A.A. , Kadekoppala, M. , Kelly, G. , Ogun, S.