Computational design and experimental verification of a symmetric protein homodimer
PDB DOI: 10.2210/pdb2mg4/pdb
Classification: DE NOVO PROTEIN Organism(s): Drosophila Melanogaster
Deposited: 2013-10-26 Deposition Author(s): Hsu, F.C. , Huang, P.S. , Huang, S.J. , Mayo, S.L. , Mou, Y.
Method: SOLUTION NMR Resolution: N.A.
Computational design and experimental verification of a symmetric protein homodimer
Hsu, F.C. , Huang, P.S. , Huang, S.J. , Mayo, S.L. , Mou, Y.
Primary Citation of Related Structures: 2MG4
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Computational designed homodimer | A | 66 | Drosophila Melanogaster | MEKRPRTEFSEEQKKALDLAFYFDRRLTPEWRRYLSQRLGLNEEQIERWFRRKEQQIGWSHPQFEK |
| Computational designed homodimer | B | 66 | Drosophila Melanogaster | MEKRPRTEFSEEQKKALDLAFYFDRRLTPEWRRYLSQRLGLNEEQIERWFRRKEQQIGWSHPQFEK |
Method: SOLUTION NMR
Deposited Date: 2013-10-26 Deposition Author(s): Hsu, F.C. , Huang, P.S. , Huang, S.J. , Mayo, S.L. , Mou, Y.