Nmr spatial structure of mutant dimeric tm domain of vegfr2 receptor
PDB DOI: 10.2210/pdb2meu/pdb
Classification: SIGNALING PROTEIN Organism(s): Salmonella Enterica
Deposited: 2013-10-02 Deposition Author(s): Arseniev, A.S. , Kirpichnikov, M.P. , Lyukmanova, E.N. , Mineev, K.S. , Shulepko, M.A.
Nmr spatial structure of mutant dimeric tm domain of vegfr2 receptor
Arseniev, A.S. , Kirpichnikov, M.P. , Lyukmanova, E.N. , Mineev, K.S. , Shulepko, M.A.
Primary Citation of Related Structures: 2MEU
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Vascular endothelial growth factor receptor 2 | A | 37 | Salmonella Enterica | EKTNLEIIILVETAVIAMEFWLLLVIILRTVKRANGG |
Vascular endothelial growth factor receptor 2 | B | 37 | Salmonella Enterica | EKTNLEIIILVETAVIAMEFWLLLVIILRTVKRANGG |
Method: SOLUTION NMR
Deposited Date: 2013-10-02 Deposition Author(s): Arseniev, A.S. , Kirpichnikov, M.P. , Lyukmanova, E.N. , Mineev, K.S. , Shulepko, M.A.