Solution structure of the third double-stranded rna-binding domain (dsrbd3) of human adenosine-deaminase adar1
PDB DOI: 10.2210/pdb2mdr/pdb
Classification: HYDROLASE Organism(s): Homo Sapiens
Deposited: 2013-09-17 Deposition Author(s): Allain, F.H. , Banerjee, S. , Barraud, P. , Jantsch, M.F. , Mohamed, W.I.
Solution structure of the third double-stranded rna-binding domain (dsrbd3) of human adenosine-deaminase adar1
Allain, F.H. , Banerjee, S. , Barraud, P. , Jantsch, M.F. , Mohamed, W.I.
Primary Citation of Related Structures: 2MDR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Double-stranded RNA-specific adenosine deaminase | A | 113 | Homo Sapiens | GSSHHHHHHSSGLVPRGSHMMPNKVRKIGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAADAALRVLIGENEKAER |
Method: SOLUTION NMR
Deposited Date: 2013-09-17 Deposition Author(s): Allain, F.H. , Banerjee, S. , Barraud, P. , Jantsch, M.F. , Mohamed, W.I.