Solution structure of shk-like immunomodulatory peptide from brugia malayi (filarial worm)
PDB DOI: 10.2210/pdb2mcr/pdb
Classification: IMMUNE SYSTEM Organism(s): N.A.
Deposited: 2013-08-22 Deposition Author(s): Chang, S.C. , Chhabra, S. , Norton, R.S. , Pennington, M.W. , Swarbrick, J.D.
Solution structure of shk-like immunomodulatory peptide from brugia malayi (filarial worm)
Chang, S.C. , Chhabra, S. , Norton, R.S. , Pennington, M.W. , Swarbrick, J.D.
Primary Citation of Related Structures: 2MCR
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Probable zinc metalloproteinase, putative | A | 37 | N.A. | VCEDLNAHCEMWQQLGHCQYSPKYMGHYCKKACGLCX |
Method: SOLUTION NMR
Deposited Date: 2013-08-22 Deposition Author(s): Chang, S.C. , Chhabra, S. , Norton, R.S. , Pennington, M.W. , Swarbrick, J.D.