Solution nmr structure of the rxfp2 ldla module
PDB DOI: 10.2210/pdb2m96/pdb
Classification: MEMBRANE PROTEIN Organism(s): Salmonella Enterica
Deposited: 2013-06-03 Deposition Author(s): Bathgate, A.D. , Gooley, P.R. , Petrie, E.J.
Solution nmr structure of the rxfp2 ldla module
Bathgate, A.D. , Gooley, P.R. , Petrie, E.J.
Primary Citation of Related Structures: 2M96
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Relaxin receptor 2 | A | 44 | Salmonella Enterica | GSMITPSCQKGYFPCGNLTKCLPRAFHCDGKDDCGNGADEENCG |
Method: SOLUTION NMR
Deposited Date: 2013-06-03 Deposition Author(s): Bathgate, A.D. , Gooley, P.R. , Petrie, E.J.