Structural and functional analysis of transmembrane segment iv of the salt tolerance protein sod2
PDB DOI: 10.2210/pdb2m7x/pdb
Classification: MEMBRANE PROTEIN Organism(s): Schizosaccharomyces Pombe
Deposited: 2013-05-02 Deposition Author(s): Alves, C. , Fliegel, L. , Kemp, G. , Lee, B. , Sykes, B.D. , Ullah, A. , Young, H.
Structural and functional analysis of transmembrane segment iv of the salt tolerance protein sod2
Alves, C. , Fliegel, L. , Kemp, G. , Lee, B. , Sykes, B.D. , Ullah, A. , Young, H.
Primary Citation of Related Structures: 2M7X
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Na(+)/H(+) antiporter | A | 38 | Schizosaccharomyces Pombe | GSKKKLFPQINFLGSLLIAGCITSTDPVLSALIVGKKK |
Method: SOLUTION NMR
Deposited Date: 2013-05-02 Deposition Author(s): Alves, C. , Fliegel, L. , Kemp, G. , Lee, B. , Sykes, B.D. , Ullah, A. , Young, H.