2M7T
Solution nmr structure of engineered cystine knot protein 2.5d
PDB DOI: 10.2210/pdb2m7t/pdb
Classification: PROTEIN BINDING Organism(s): Synthetic Construct
Deposited: 2013-04-30 Deposition Author(s): Cochran, F.V. , Das, R.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of engineered cystine knot protein 2.5d
Primary Citation of Related Structures: 2M7T
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cystine Knot Protein 2.5D | A | 33 | Synthetic Construct | GCPQGRGDWAPTSCSQDSDCLAGCVCGPNGFCG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2013-04-30 Deposition Author(s): Cochran, F.V. , Das, R.