Solution nmr structure of engineered cystine knot protein 2.5d
PDB DOI: 10.2210/pdb2m7t/pdb
Classification: PROTEIN BINDING Organism(s): Fremyella Diplosiphon
Deposited: 2013-04-30 Deposition Author(s): Cochran, F.V. , Das, R.
Solution nmr structure of engineered cystine knot protein 2.5d
Primary Citation of Related Structures: 2M7T
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Cystine Knot Protein 2.5D | A | 33 | Fremyella Diplosiphon | GCPQGRGDWAPTSCSQDSDCLAGCVCGPNGFCG |
Method: SOLUTION NMR
Deposited Date: 2013-04-30 Deposition Author(s): Cochran, F.V. , Das, R.