N-terminal domain of ehcabp1 structure
PDB DOI: 10.2210/pdb2m7m/pdb
Classification: METAL BINDING PROTEIN Organism(s): Entamoeba Histolytica
Deposited: 2013-04-26 Deposition Author(s): Bhattacharya, A. , Chary, K.V. , Patel, S. , Rout, A.K.
N-terminal domain of ehcabp1 structure
Bhattacharya, A. , Chary, K.V. , Patel, S. , Rout, A.K.
Primary Citation of Related Structures: 2M7M
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Calcium-binding protein | A | 66 | Entamoeba Histolytica | MAEALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEIDQNEFAKFYGSIQ |
Method: SOLUTION NMR
Deposited Date: 2013-04-26 Deposition Author(s): Bhattacharya, A. , Chary, K.V. , Patel, S. , Rout, A.K.