2M76
Structure of the regulatory domain of human brain carnitine palmitoyltransferase 1
PDB DOI: 10.2210/pdb2m76/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2013-04-18 Deposition Author(s): Samanta, S. , Situ, A.J. , Ulmer, T.S.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structure of the regulatory domain of human brain carnitine palmitoyltransferase 1
Samanta, S. , Situ, A.J. , Ulmer, T.S.
Primary Citation of Related Structures: 2M76
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Carnitine O-palmitoyltransferase 1, brain isoform | A | 50 | Homo Sapiens | MAEAHQAVGFRPSLTSDGAEVELSAPVLQEIYLSGLRSWKRHLSRFWNDF |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2013-04-18 Deposition Author(s): Samanta, S. , Situ, A.J. , Ulmer, T.S.