Novel method of protein purification for structural research. example of ultra high resolution structure of spi-2 inhibitor by x-ray and nmr spectroscopy.
PDB DOI: 10.2210/pdb2m5x/pdb
Classification: HYDROLASE inhibitor Organism(s): Galleria Mellonella
Deposited: 2013-03-12 Deposition Author(s): Bal, W. , Dvornyk, A. , Grzelak, K. , Kludkiewicz, B. , Kopera, E. , Lenarcic Zivkovic, M. , Zagorski-Ostoja, W. , Zhukov, I.
Novel method of protein purification for structural research. example of ultra high resolution structure of spi-2 inhibitor by x-ray and nmr spectroscopy.
Bal, W. , Dvornyk, A. , Grzelak, K. , Kludkiewicz, B. , Kopera, E. , Lenarcic Zivkovic, M. , Zagorski-Ostoja, W. , Zhukov, I.
Primary Citation of Related Structures: 2M5X
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Silk protease inhibitor 2 | A | 40 | Galleria Mellonella | EAAVCTTEWDPVCGKDGKTYSNLCWLNEAGVGLDHEGECL |
Method: SOLUTION NMR
Deposited Date: 2013-03-12 Deposition Author(s): Bal, W. , Dvornyk, A. , Grzelak, K. , Kludkiewicz, B. , Kopera, E. , Lenarcic Zivkovic, M. , Zagorski-Ostoja, W. , Zhukov, I.