Solution structure of the rrm domain of the hypothetical protein cagl0m09691g from candida glabrata
PDB DOI: 10.2210/pdb2m4m/pdb
Classification: UNKNOWN FUNCTION Organism(s): Candida Glabrata
Deposited: 2013-02-07 Deposition Author(s): Ahmed, M. , Almo, S.C. , Attonito, J. , Bonanno, J.B. , Chamala, S. , Chook, Y.M. , Evans, B. , Girvin, M.E. , Hammonds, J. , Harris, R. , Hillerich, B. , Lafleur, J. , Love, J. , New York Structural Genomics Research Consortium (Nysgrc) , Nucleocytoplasmic Transport: A Target For Cellular Control (Npcxstals) , Patel, H. , Rout, M.P. , Seidel, R.D. , Stead, M. , Washington, E.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the rrm domain of the hypothetical protein cagl0m09691g from candida glabrata
Ahmed, M. , Almo, S.C. , Attonito, J. , Bonanno, J.B. , Chamala, S. , Chook, Y.M. , Evans, B. , Girvin, M.E. , Hammonds, J. , Harris, R. , Hillerich, B. , Lafleur, J. , Love, J. , New York Structural Genomics Research Consortium (Nysgrc) , Nucleocytoplasmic Transport: A Target For Cellular Control (Npcxstals) , Patel, H. , Rout, M.P. , Seidel, R.D. , Stead, M. , Washington, E.
Primary Citation of Related Structures: 2M4M
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| hypothetical protein | A | 124 | Candida Glabrata | MSLGSESETGNAVVVFGYREAITKQILAYFAQFGEILEDLESELGDTETMRTPGYFFQQAPNRRRISREHGRTWTKLTYANHSSYLRALREHGTIYCGAAIGCVPYKHELISELSREGHHHHHH |
Method: SOLUTION NMR
Deposited Date: 2013-02-07 Deposition Author(s): Ahmed, M. , Almo, S.C. , Attonito, J. , Bonanno, J.B. , Chamala, S. , Chook, Y.M. , Evans, B. , Girvin, M.E. , Hammonds, J. , Harris, R. , Hillerich, B. , Lafleur, J. , Love, J. , New York Structural Genomics Research Consortium (Nysgrc) , Nucleocytoplasmic Transport: A Target For Cellular Control (Npcxstals) , Patel, H. , Rout, M.P. , Seidel, R.D. , Stead, M. , Washington, E.