Structure and dynamics of a human nedd4 ww domain-enac complex
PDB DOI: 10.2210/pdb2m3o/pdb
Classification: PEPTIDE BINDING PROTEIN/PROTEIN BINDING Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2013-01-23 Deposition Author(s): Bobby, R. , Brimble, M.A. , Dingley, A.J. , Lee, V. , Lott, J. , Macdonald, F.J. , Medini, K. , Neudecker, P.
Structure and dynamics of a human nedd4 ww domain-enac complex
Bobby, R. , Brimble, M.A. , Dingley, A.J. , Lee, V. , Lott, J. , Macdonald, F.J. , Medini, K. , Neudecker, P.
Primary Citation of Related Structures: 2M3O
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase NEDD4 | W | 43 | Homo Sapiens , Synthetic Construct | GSMEQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPA |
| Amiloride-sensitive sodium channel subunit alpha | P | 11 | Homo Sapiens , Synthetic Construct | TAPPPAYATLG |
Method: SOLUTION NMR
Deposited Date: 2013-01-23 Deposition Author(s): Bobby, R. , Brimble, M.A. , Dingley, A.J. , Lee, V. , Lott, J. , Macdonald, F.J. , Medini, K. , Neudecker, P.