The zz domain of cytoplasmic polyadenylation element binding protein 1 (cpeb1)
PDB DOI: 10.2210/pdb2m13/pdb
Classification: METAL BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2012-11-14 Deposition Author(s): Elazzouzi, F. , Hilburn, B.C. , Lee, B.M. , Merkel, D.J. , Perez-Alvarado, G.C. , Wells, S.B.
The zz domain of cytoplasmic polyadenylation element binding protein 1 (cpeb1)
Elazzouzi, F. , Hilburn, B.C. , Lee, B.M. , Merkel, D.J. , Perez-Alvarado, G.C. , Wells, S.B.
Primary Citation of Related Structures: 2M13
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cytoplasmic polyadenylation element-binding protein 1 | A | 65 | Homo Sapiens | GPVQIDPYLEDSLCHICSSQPGPFFCRDQVCFKYFCRSCWHWRHSMEGLRHHSPLMRNQKNRDSS |
Method: SOLUTION NMR
Deposited Date: 2012-11-14 Deposition Author(s): Elazzouzi, F. , Hilburn, B.C. , Lee, B.M. , Merkel, D.J. , Perez-Alvarado, G.C. , Wells, S.B.