2M0O
The solution structure of human phf1 in complex with h3k36me3
PDB DOI: 10.2210/pdb2m0o/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2012-10-30 Deposition Author(s): Patel, D.J. , Song, J.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
The solution structure of human phf1 in complex with h3k36me3
Primary Citation of Related Structures: 2M0O
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PHD finger protein 1 | A | 79 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAAL |
| H3K36me3 peptide | B | 11 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ATGGVKKPHRY |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2012-10-30 Deposition Author(s): Patel, D.J. , Song, J.