Smurf2 ww3 domain in complex with a smad7 derived peptide
PDB DOI: 10.2210/pdb2ltz/pdb
Classification: PROTEIN BINDING/PEPTIDE Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2012-06-04 Deposition Author(s): Aragon, E. , Gao, S. , Goerner, N. , Lopes, T. , Macias, M.J. , Massague, J. , Xi, Q.
Method: SOLUTION NMR Resolution: N.A.
Smurf2 ww3 domain in complex with a smad7 derived peptide
Aragon, E. , Gao, S. , Goerner, N. , Lopes, T. , Macias, M.J. , Massague, J. , Xi, Q.
Primary Citation of Related Structures: 2LTZ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
E3 ubiquitin-protein ligase SMURF2 | A | 37 | Homo Sapiens , Synthetic Construct | GPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSAN |
Smad7 derived peptide | B | 15 | Homo Sapiens , Synthetic Construct | ELESPPPPYSRYPMD |
Method: SOLUTION NMR
Deposited Date: 2012-06-04 Deposition Author(s): Aragon, E. , Gao, S. , Goerner, N. , Lopes, T. , Macias, M.J. , Massague, J. , Xi, Q.