Smurf1 ww2 domain in complex with a smad7 derived peptide
PDB DOI: 10.2210/pdb2ltx/pdb
Classification: PROTEIN BINDING/PEPTIDE Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2012-06-04 Deposition Author(s): Aragon, E. , Gao, S. , Goerner, N. , Lopes, T. , Macias, M.J. , Massague, J. , Xi, Q.
Smurf1 ww2 domain in complex with a smad7 derived peptide
Aragon, E. , Gao, S. , Goerner, N. , Lopes, T. , Macias, M.J. , Massague, J. , Xi, Q.
Primary Citation of Related Structures: 2LTX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| E3 ubiquitin-protein ligase SMURF1 | A | 35 | Homo Sapiens , Synthetic Construct | GPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLH |
| Smad7 derived peptide | B | 15 | Homo Sapiens , Synthetic Construct | ELESPPPPYSRYPMD |
Method: SOLUTION NMR
Deposited Date: 2012-06-04 Deposition Author(s): Aragon, E. , Gao, S. , Goerner, N. , Lopes, T. , Macias, M.J. , Massague, J. , Xi, Q.