Solution structure of chchd7
PDB DOI: 10.2210/pdb2lqt/pdb
Classification: UNKNOWN FUNCTION Organism(s): Homo Sapiens
Deposited: 2012-03-14 Deposition Author(s): Banci, L. , Bertini, I. , Ciofi-Baffoni, S. , Winkelmann, J.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of chchd7
Banci, L. , Bertini, I. , Ciofi-Baffoni, S. , Winkelmann, J.
Primary Citation of Related Structures: 2LQT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Coiled-coil-helix-coiled-coil-helix domain-containing protein 7 | A | 85 | Homo Sapiens | MPSVTQRLRDPDINPCLSESDASTRCLDENNYDRERCSTYFLRYKNCRRFWNSIVMQRRKNGVKPFMPTAAERDEILRAVGNMPY |
Method: SOLUTION NMR
Deposited Date: 2012-03-14 Deposition Author(s): Banci, L. , Bertini, I. , Ciofi-Baffoni, S. , Winkelmann, J.