Solution nmr structure of tstm1273 from salmonella typhimurium lt2, nesg target stt322, csgid target idp01027 and ocsp target tstm1273
PDB DOI: 10.2210/pdb2loj/pdb
Classification: Structural Genomics, Unknown Function Organism(s): Staphylococcus Aureus Subsp. Aureus Mw2
Deposited: 2012-01-24 Deposition Author(s): Anderson, W.F. , Arrowsmith, C.H. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Garcia, M. , Houliston, S. , Northeast Structural Genomics Consortium (Nesg) , Ontario Centre For Structural Proteomics (Ocsp) , Savchenko, A. , Wu, B. , Yee, A.
Solution nmr structure of tstm1273 from salmonella typhimurium lt2, nesg target stt322, csgid target idp01027 and ocsp target tstm1273
Anderson, W.F. , Arrowsmith, C.H. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Garcia, M. , Houliston, S. , Northeast Structural Genomics Consortium (Nesg) , Ontario Centre For Structural Proteomics (Ocsp) , Savchenko, A. , Wu, B. , Yee, A.
Primary Citation of Related Structures: 2LOJ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Putative cytoplasmic protein | A | 63 | Staphylococcus Aureus Subsp. Aureus Mw2 | MSRMDNTELPHPKEIDNETLLPAAERRVNSQALLGPDGKVIIDHNGQEYLLRKTQAGKLLLTK |
Method: SOLUTION NMR
Deposited Date: 2012-01-24 Deposition Author(s): Anderson, W.F. , Arrowsmith, C.H. , Center For Structural Genomics Of Infectious Diseases (Csgid) , Garcia, M. , Houliston, S. , Northeast Structural Genomics Consortium (Nesg) , Ontario Centre For Structural Proteomics (Ocsp) , Savchenko, A. , Wu, B. , Yee, A.