Solution nmr structure of the novel conotoxin im23a from conus imperialis
PDB DOI: 10.2210/pdb2lmz/pdb
Classification: TOXIN Organism(s): Conus Imperialis
Deposited: 2011-12-15 Deposition Author(s): Boonyalai, N. , Galea, C.A. , Khoo, K.K. , Norton, R.S.
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of the novel conotoxin im23a from conus imperialis
Boonyalai, N. , Galea, C.A. , Khoo, K.K. , Norton, R.S.
Primary Citation of Related Structures: 2LMZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Conotoxin im17a | A | 42 | Conus Imperialis | IPYCGQTGAECYSWCIKQDLSKDWCCDFVKDIRMNPPADKCP |
Method: SOLUTION NMR
Deposited Date: 2011-12-15 Deposition Author(s): Boonyalai, N. , Galea, C.A. , Khoo, K.K. , Norton, R.S.